PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV51111.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family ARF
Protein Properties Length: 684aa    MW: 75561.4 Da    PI: 7.4131
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV51111.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3781e-24150251199
                 EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                 f+k+lt sd++++g +++p++ ae++      + +++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv+ ++L +gD v+F +    ++el+
  KZV51111.1 150 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyK-QQRPSQELVAKDLHGFEWKFRHIYRGQPRRHLLTTGWSAFVNKKKLTSGDAVLFLR--GGDGELR 245
                 99****************************963.3445679************************************************3..378999* PP

                 EEEE-S CS
          B3  94 vkvfrk 99 
                 ++++r+
  KZV51111.1 246 LGIRRA 251
                 ***997 PP

2Auxin_resp97.51.9e-32276355182
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                 ++++++ +s+F+++YnPr  + + +v+++k++k+l++++s GmRfk++fetedss+r+  G+++gvsd+dp+rWp+SkW++L
  KZV51111.1 276 VVNSITIQSTFNICYNPRGHSYDIIVPYQKFSKSLTHSFSSGMRFKIRFETEDSSQRS--GLIIGVSDVDPIRWPGSKWKCL 355
                 5788999**************************************************9..*********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.107.1E-40146253IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-42146256IPR015300DNA-binding pseudobarrel domain
CDDcd100174.50E-22148250No hitNo description
PfamPF023621.1E-22150251IPR003340B3 DNA binding domain
PROSITE profilePS5086313.549150252IPR003340B3 DNA binding domain
SMARTSM010196.7E-24150252IPR003340B3 DNA binding domain
PfamPF065073.7E-27277355IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0010582Biological Processfloral meristem determinacy
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 684 aa     Download sequence    Send to blast
MMCGLIDLNT VSTEDETVSL SGSPSSSAAS ANSDLVKTPS SAVCMELWHA CAGPLISLPK  60
KGSAVVYFPQ GHVEHLPEHP AITYDLPPHV FCRVIDVKLH ADATNDEVYA LVSLVPDQQI  120
EQKWRDGIFE AEAEDEDVED VGKSMTPHMF CKTLTASDTS THGGFSVPRR AAEDCFPPLD  180
YKQQRPSQEL VAKDLHGFEW KFRHIYRGQP RRHLLTTGWS AFVNKKKLTS GDAVLFLRGG  240
DGELRLGIRR ATQIKSGVTI LASNGQQFNA SSIAGVVNSI TIQSTFNICY NPRGHSYDII  300
VPYQKFSKSL THSFSSGMRF KIRFETEDSS QRSGLIIGVS DVDPIRWPGS KWKCLLVRWD  360
DMEVNRLCRV SPWEIEPSAP VSGPNSLVLP GAKRSRVSFP ATKADFLAPR DESGISDFGE  420
PLRIHKVLQG QEVFRFHPSY TARDAPIKLP ADTRCLPGLI EPRIQAEGNG IIPHHADACN  480
SFEGTTLFNK PFQFHKVLQG QETVSIRPFG PRSEPCQAYE NNATHVLNGV QVSNNGNGWS  540
TLSHVYNTET PFSPLLVPGS SPPALMLQQS NPPPSQFMSY LYGTRKKIET NNIGDSFSAS  600
LRIPSSFPSS ETTAQLPPPS IRSSEPSEEH KQMRLSQLYR DNQKFVSMCK KSCRLFGFPL  660
TEGKVATTKG DNPAAPACNE ERLC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_B1e-1034037716354Auxin response factor 1
4ldy_A1e-1034037716354Auxin response factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00021PBMTransfer from AT2G33860Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096446.10.0PREDICTED: auxin response factor 3
SwissprotO236610.0ARFC_ARATH; Auxin response factor 3
TrEMBLA0A022QL990.0A0A022QL99_ERYGU; Auxin response factor
STRINGPGSC0003DMT4000812820.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61012333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.11e-178ARF family protein